General Information

  • ID:  hor000661
  • Uniprot ID:  A0A8C5FRW9
  • Protein name:  Calcitonin gene-related peptide
  • Gene name:  calcb
  • Organism:  Gadus morhua (Atlantic cod)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gadus (genus), Gadidae (family), Gadoidei (suborder), Gadiformes (order), Gadariae, Zeiogadaria, Paracanthopterygii, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ACNTATCVTHRLADFLSRSGGIGNSNFVPTNVGSKAF
  • Length:  37(81-117)
  • Propeptide:  MVVLKISVFLVAYTLVICQMYCSQAAPARPGMESMSERVTLTDYEARRLLNAIVKEFVQMTAEEMDQQAVEGNSVTAQKRACNTATCVTHRLADFLSRSGGIGNSNFVPTNVGSKAFGRRRRNAQA
  • Signal peptide:  MVVLKISVFLVAYTLVIC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  inhibited the motility of spontaneously active ring preparations from the cod intestine
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000661_AF2.pdbhor000661_ESM.pdb

Physical Information

Mass: 445657 Formula: C163H258N50O52S2
Absent amino acids: EMQWY Common amino acids: AGNST
pI: 8.83 Basic residues: 4
Polar residues: 18 Hydrophobic residues: 13
Hydrophobicity: 6.76 Boman Index: -4983
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65.95
Instability Index: 2101.62 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  9688955
  • Title:  Primary Structure, Distribution, and Effects on Motility of CGRP in the Intestine of the Cod Gadus Morhua